Rhizobium etli CIAT 652: RHECIAT_PC0000683 Help Entry RHECIAT_PC0000683 CDS       T00720                                  Symbol vbsG Name (GenBank) polyketide synthase protein   KO K05375   MbtH protein Organism rec  Rhizobium etli CIAT 652 Pathway rec00261   Monobactam biosynthesis rec01100   Metabolic pathways rec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rec00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RHECIAT_PC0000683 (vbsG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rec01008]     RHECIAT_PC0000683 (vbsG) Polyketide biosynthesis proteins [BR:rec01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RHECIAT_PC0000683 (vbsG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACE94760 UniProt:  B3Q3K3 LinkDB All DBs Position pC:complement(741237..741455) Genome browser AA seq 72 aa AA seqDB search MDNLEPRDDLWIVVIDTERHYSVWPQDKRIPVSWEAAGFAGSRQECLAHIRGVWTDPRPL SLRSAMAGDARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacaatcttgagccccgcgacgatctctggatcgtcgtcatcgacaccgagcgccac tactcggtctggccgcaggacaagcggattccggtgagctgggaggccgcgggctttgcc ggttcacgccaggaatgcctggcccatatccgcggcgtctggaccgatccccgcccgctc tccctgcgctcggcgatggccggcgatgcgcgtctctga

DBGET integrated database retrieval system