Rhizobium etli bv. mimosae IE4771: IE4771_PD00520 Help Entry IE4771_PD00520    CDS       T03310                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rei  Rhizobium etli bv. mimosae IE4771 Pathway rei00261   Monobactam biosynthesis rei01100   Metabolic pathways rei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rei00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IE4771_PD00520  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rei01008]     IE4771_PD00520 Polyketide biosynthesis proteins [BR:rei01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IE4771_PD00520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIC31074 UniProt:  A0A060IBR9 LinkDB All DBs Position pRetIE4771d:complement(552283..552501) Genome browser AA seq 72 aa AA seqDB search MDNLEPRDDLWIVVIDTEHHYSVWPQDKRIPVSWEAAGFAGSRQECLAHIREIWTDPRPL SLRSAMAADARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacaatcttgagccccgcgacgatctctggatcgtcgtcatcgacaccgagcaccac tactcggtctggccgcaggacaagcggattccggtgagctgggaggccgcgggctttgcc ggttcgcgccaggaatgcctggcccatatccgcgagatctggaccgatccccgcccactc tccctgcgctcggcaatggccgctgacgcacgtctctga

DBGET integrated database retrieval system