Rhizobium etli bv. mimosae Mim1: REMIM1_PF00418 Help Entry REMIM1_PF00418    CDS       T02778                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rel  Rhizobium etli bv. mimosae Mim1 Pathway rel00261   Monobactam biosynthesis rel01100   Metabolic pathways rel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rel00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     REMIM1_PF00418  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rel01008]     REMIM1_PF00418 Polyketide biosynthesis proteins [BR:rel01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     REMIM1_PF00418 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGS26084 UniProt:  S5SX61 LinkDB All DBs Position pRetMIM1f:443013..443231 Genome browser AA seq 72 aa AA seqDB search MDNLEPRDDLWIVVIDTEHHYSVWPQDKRIPVSWKAAGFAGSRQECLAHIREIWTDPRPL SLRSALAADARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacaatcttgagccccgcgacgatctctggatcgtcgtcatcgacaccgagcaccac tactcggtctggccgcaggacaagcggattccggtgagctggaaggccgcgggctttgcc ggttcgcgccaggaatgcctggcccatatccgcgaaatctggaccgatccccgcccgctc tccctgcgctcggccttggccgctgacgcacgtctctga

DBGET integrated database retrieval system