Rhizobium etli bv. phaseoli IE4803: IE4803_PC00510 Help Entry IE4803_PC00510    CDS       T03667                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rep  Rhizobium etli bv. phaseoli IE4803 Pathway rep00261   Monobactam biosynthesis rep01100   Metabolic pathways rep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rep00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IE4803_PC00510  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rep01008]     IE4803_PC00510 Polyketide biosynthesis proteins [BR:rep01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IE4803_PC00510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJC83055 LinkDB All DBs Position pRetIE4803c:complement(535812..536030) Genome browser AA seq 72 aa AA seqDB search MDNLEPRDDLWIVVIDTEHHYSVWPQDKRIPVSWEAAGFAGSRQECLAHIREIWTDPRPL SLRSAMAADARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacaatcttgagccccgcgacgatctctggatcgtcgtcatcgacaccgagcaccac tactcggtctggccgcaggacaagcggattccggtgagctgggaggccgcgggctttgcc ggttcgcgccaggaatgcctggcccatatccgcgagatctggaccgatccccgcccactc tccctgcgctcggcaatggccgctgacgcacgtctctga

DBGET integrated database retrieval system