Prescottella equi: REQ_23800 Help Entry REQ_23800         CDS       T01352                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism req  Prescottella equi Pathway req00261   Monobactam biosynthesis req01100   Metabolic pathways req01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:req00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     REQ_23800  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:req01008]     REQ_23800 Polyketide biosynthesis proteins [BR:req01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     REQ_23800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CBH48422 UniProt:  A0A3S5Y7F3 LinkDB All DBs Position 2505945..2506214 Genome browser AA seq 89 aa AA seqDB search MVCITFRRQRSRGETVTNPFDDADAEYLVLVNEENQHSLWPAFADVPSGWAVVHDRDTRR ACVAYIDAHWTDLRPPATVVGSEHDSSLG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggtgtgcatcacatttcgtcgacaacgatcgagaggtgagacggtgaccaatccgttc gacgacgccgatgccgaatacctggtgctggtcaacgaggagaaccagcattcactctgg cccgccttcgcggacgttccgtccggctgggccgtagtgcacgaccgggacacgcgccgc gcctgcgtcgcctacatcgatgcgcactggaccgatctgcggccgccggcaacggtcgtc ggatcggagcatgattcgtcgctcggctag

DBGET integrated database retrieval system