Rhodococcus globerulus: KYT97_24590 Help Entry KYT97_24590       CDS       T07544                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rgo  Rhodococcus globerulus Pathway rgo00261   Monobactam biosynthesis rgo01100   Metabolic pathways rgo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KYT97_24590  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rgo01008]     KYT97_24590 Polyketide biosynthesis proteins [BR:rgo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KYT97_24590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXW01480 LinkDB All DBs Position 5393096..5393341 Genome browser AA seq 81 aa AA seqDB search MSTNPFDDEDGRFYVLVNDEDQHSLWPTFSEVPAGWRVVFGEESRAACLEYVEKNWTDMR PKSLREAMEADQAAAGRSSES NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcactaatcctttcgatgacgaagacggacgcttctacgtgctggtgaacgacgag gaccagcattcgctgtggcccacgttctccgaggtccctgcgggctggcgtgtggtgttc ggcgaagagagccgggcagcgtgcctcgagtacgtggagaagaactggaccgacatgcgt cccaagagtctgcgcgaggcgatggaagcagaccaggctgcagcaggacgcagctcggag agctga

DBGET integrated database retrieval system