Rhodococcus gordoniae: NMQ04_03035 Help Entry NMQ04_03035       CDS       T08682                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rgor  Rhodococcus gordoniae Pathway rgor00261   Monobactam biosynthesis rgor01100   Metabolic pathways rgor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rgor00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NMQ04_03035  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rgor01008]     NMQ04_03035 Polyketide biosynthesis proteins [BR:rgor01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NMQ04_03035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UTT49201 LinkDB All DBs Position 644518..644754 Genome browser AA seq 78 aa AA seqDB search MSTNPFDDEDGRFYVLINDEEQYSLWPTFAEVPQGWRVVFGEESRAACVEYVEQHWTDMR PKSLRDAMEADEKARQGS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcacgaatccatttgacgacgaagacggccgcttctacgtcctcatcaacgatgag gagcagtactcgctgtggccgaccttcgccgaggttccgcaggggtggcgggtggtattc ggcgaagagtcgcgcgccgcttgcgtcgagtacgtcgagcagcattggaccgacatgcgt ccgaagagccttcgcgacgcaatggaagccgacgagaaggcccgccagggcagctga

DBGET integrated database retrieval system