Rhodoferax sediminis Gr-4: EXZ61_18225 Help Entry EXZ61_18225       CDS       T06176                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rhg  Rhodoferax sediminis Gr-4 Pathway rhg00790   Folate biosynthesis rhg01100   Metabolic pathways rhg01240   Biosynthesis of cofactors Module rhg_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rhg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EXZ61_18225 Enzymes [BR:rhg01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      EXZ61_18225  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      EXZ61_18225  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      EXZ61_18225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QDL55956 UniProt:  A0A515ETE7 LinkDB All DBs Position 3939045..3939416 Genome browser AA seq 123 aa AA seqDB search MHHTTGTQTLTLTGLRFNASLGILESEKTDPQPIQVDAELHLGTQPLLPHDDDINHVLDY RKVRQIIINECTVEHVNLLESLIGKLAHRLMQLPGVLGVRVKIAKLEIFSDCEVAIKVET GQW NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcaccacaccacaggcacgcagaccctaacccttaccggcctgcgtttcaacgccagc cttggcattctggaatccgaaaaaaccgatccccagcccatccaagtcgatgccgagctg cacttgggcacccagcccctgctaccccacgacgacgacatcaaccacgtgctggactac cgcaaggtgcgccaaatcatcatcaacgagtgcactgtagaacacgtcaacttgctagaa agcctgatcggcaaactggcccaccgtctgatgcaactgcctggcgtgctgggcgtgcgg gtcaaaatagccaagctcgaaatctttagcgactgtgaagtggccatcaaggtggaaacc gggcaatggtga

DBGET integrated database retrieval system