Rhizobium sp. Kim5: Kim5_PC00467 Help Entry Kim5_PC00467      CDS       T05501                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rhk  Rhizobium sp. Kim5 Pathway rhk00261   Monobactam biosynthesis rhk01100   Metabolic pathways rhk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Kim5_PC00467  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rhk01008]     Kim5_PC00467 Polyketide biosynthesis proteins [BR:rhk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Kim5_PC00467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARQ61878 LinkDB All DBs Position pRetKim5c:complement(503624..503842) Genome browser AA seq 72 aa AA seqDB search MDNLEPRDDLWIVVIDTEHHYSVWPQDKRIPVSWEAAGFAGSRQECLAHIREIWTDPRPL SLRSAMAADARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacaatcttgagccccgcgacgatctctggatcgtcgtcatcgacaccgagcaccac tactcggtctggccgcaggacaagcggattccggtgagctgggaggccgcgggctttgcc ggttcgcgccaggaatgcctggcccatatccgcgagatctggaccgatccccgcccgctc tccctgcgctcggcaatggccgctgacgcacgtctctga

DBGET integrated database retrieval system