Rhodococcus sp. 008: AOT96_13915 Help Entry AOT96_13915       CDS       T05462                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rhod  Rhodococcus sp. 008 Pathway rhod00790   Folate biosynthesis rhod01100   Metabolic pathways rhod01240   Biosynthesis of cofactors Module rhod_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rhod00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AOT96_13915 Enzymes [BR:rhod01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AOT96_13915  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AOT96_13915  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AOT96_13915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ANQ71829 LinkDB All DBs Position 2984611..2984976 Genome browser AA seq 121 aa AA seqDB search MGDRIELRGLKVRGNHGVFDHEKRDGQDFFIDITVWMDLAPAAASDDLTQTLHYGELAEA AAAIVAGPSRDLIETVAAEIADDVMKDSRVESVEVVVHKPSAPIPLVFADVAVVAHRTRS A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgggggaccgaatcgaattgcgcggactgaaggttcgcggcaatcacggagtgttcgac cacgagaagcgtgacggtcaggacttcttcatcgacatcaccgtgtggatggacttggct cccgccgcggcgtcggacgacctgacgcagaccctgcactacggcgagttggcggaagcc gccgcagcgatagtcgccggcccgtcgcgcgatctcatcgagaccgtcgccgcggagatc gccgacgacgtcatgaaagattcgcgagtcgagagcgtcgaggttgttgtccacaaaccg tcggcaccgattccgctggtttttgcggacgtcgccgtcgtcgcacatcggacccgatcg gcatga

DBGET integrated database retrieval system