Rhodococcus sp. P1Y: D8W71_22370 Help Entry D8W71_22370       CDS       T09477                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rhop  Rhodococcus sp. P1Y Pathway rhop00261   Monobactam biosynthesis rhop01100   Metabolic pathways rhop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhop00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D8W71_22370  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rhop01008]     D8W71_22370 Polyketide biosynthesis proteins [BR:rhop01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D8W71_22370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYJ50567 UniProt:  A0A494T6J1 LinkDB All DBs Position complement(4854686..4854886) Genome browser AA seq 66 aa AA seqDB search MQNNTSEWTVVRNDEEQHSIWPADKPLPLGWTSIGFSGDRDECLDHIEQVWTDIRPLSLR RALGVA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgcagaacaacacttccgaatggaccgtcgtacgcaacgacgaagagcagcactcgatc tggccggcggacaaaccgttaccgctcgggtggacgagcatcggattctccggtgatcgc gacgagtgcctcgaccacatcgagcaggtgtggaccgatatccgccctttgtccctacgc cgcgcgctgggggtggcgtga

DBGET integrated database retrieval system