Rhodococcus sp. p52: IM25_08555 Help Entry IM25_08555        CDS       T05434                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rhq  Rhodococcus sp. p52 Pathway rhq00790   Folate biosynthesis rhq01100   Metabolic pathways rhq01240   Biosynthesis of cofactors Module rhq_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rhq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IM25_08555 Enzymes [BR:rhq01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      IM25_08555  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      IM25_08555  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      IM25_08555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AOD21651 UniProt:  A0A1B2UBX2 LinkDB All DBs Position 1857170..1857550 Genome browser AA seq 126 aa AA seqDB search MSDRIELRGLTVRGNHGVFEHEKRDGQDFVVDIVVWLDLAPAAASDELADTLHYGELAER AAAIIAGPGRDLIETVAGEIADEVLTDPRVARVEVTLHKPSAPIPLTFGDVAVAIDRSRS DATGSA NT seq 381 nt NT seq  +upstreamnt  +downstreamnt gtgagcgaccgcatcgaactacggggactgacggtccgcggcaaccacggcgtcttcgag cacgagaagcgggacggtcaggacttcgtcgtcgacatcgtcgtgtggctcgatctcgcg ccggccgcggcatccgacgagctggccgacacgctgcactacggcgaactcgccgagcga gccgcggcgatcatcgccggtccgggccgcgatctcatcgagacggtcgcgggggagatc gccgacgaggtgctcaccgacccgcgtgtcgcccgggtggaggtcacgctccacaagccg tcggcgccgatcccgctgaccttcggcgacgtcgccgtggcgatcgaccgctcccgcagc gatgcgacggggagcgcctga

DBGET integrated database retrieval system