Rhizobium sp. N731: AMK02_PD00405 Help Entry AMK02_PD00405     CDS       T04809                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rhx  Rhizobium sp. N731 Pathway rhx00261   Monobactam biosynthesis rhx01100   Metabolic pathways rhx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AMK02_PD00405  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rhx01008]     AMK02_PD00405 Polyketide biosynthesis proteins [BR:rhx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AMK02_PD00405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANK89024 LinkDB All DBs Position pRspN731d:complement(439315..439533) Genome browser AA seq 72 aa AA seqDB search MDNLEPRDDFWIVVHDTEHHYSVWPQDKRIPVSWQAAGFAGSRQECLAHIRDVWPDPRPL SLRSAMAADARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacaatcttgagccccgcgacgatttctggatcgtcgtccacgacaccgagcatcac tactcggtctggccgcaggacaagcggattccggtgagctggcaggcggcgggttttgcc ggttcgcgccaggagtgcctagcccatatccgcgacgtctggcccgacccgcgcccgctc tccctgcgctcggccatggcagccgatgcacgtctctga

DBGET integrated database retrieval system