Rhodoplanes sp. Z2-YC6860: RHPLAN_23040 Help Entry RHPLAN_23040      CDS       T04290                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism rhz  Rhodoplanes sp. Z2-YC6860 Pathway rhz00261   Monobactam biosynthesis rhz01100   Metabolic pathways rhz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RHPLAN_23040  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rhz01008]     RHPLAN_23040 Polyketide biosynthesis proteins [BR:rhz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RHPLAN_23040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AMN40744 UniProt:  A0A127ER50 LinkDB All DBs Position 2669493..2669729 Genome browser AA seq 78 aa AA seqDB search MSTNPFEDENGVYHVLINDEGQYSLWPSFKDVPQGWTVAKKSDTRAACLDYINKNWTDMR PKSLIDRMEKDARNKKLN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgaagacgaaaatggcgtctatcacgtcctgatcaatgacgag gggcagtattcgctgtggccgagcttcaaggacgtgccgcagggctggacggtcgcgaaa aaatccgacacccgcgcggcctgcctcgactacatcaacaagaattggactgacatgcgg ccaaaaagtctgatcgaccgcatggaaaaagatgcgcgaaacaagaagctgaattga

DBGET integrated database retrieval system