Agrobacterium pusense IRBG74: BN877_I1336 Help Entry BN877_I1336       CDS       T02867                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rir  Agrobacterium pusense IRBG74 Pathway rir00790   Folate biosynthesis rir01100   Metabolic pathways rir01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:rir00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BN877_I1336 (folB) Enzymes [BR:rir01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BN877_I1336 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BN877_I1336 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BN877_I1336 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DinI Motif Other DBs NCBI-ProteinID:  CDI08244 UniProt:  A0A1L9CUM6 LinkDB All DBs Position 1306611..1306976 Genome browser AA seq 121 aa AA seqDB search MSRYTIILKNCSFFARHGLLEQEEVLGQRFFVDAEMEVEAGDALETDDIENTVDYGVAFA VIEKIVVGQRRYLIEALANDIAKALRARYPQIVWLRITVRKPSAPVPGILDYAQVSVEHR A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgagccgctataccatcatcctgaaaaactgttccttctttgcccgtcatggtcttctt gaacaggaagaggtgttggggcagcgctttttcgtcgatgccgagatggaggtcgaggcg ggcgacgcgctggaaaccgacgatattgagaacaccgtcgattatggcgtggctttcgcg gtcatcgaaaagatcgtcgtcggccagcgccggtatctcatagaggcgcttgcgaacgac atcgccaaggcgctgcgtgcccgttatccgcaaatcgtctggctgcgcatcacggtgcgc aagccctcggctccggttcccggtattctggattatgcacaggtgagcgttgaacaccga gcctga

DBGET integrated database retrieval system