Rhizobium jaguaris: CCGE525_37010 Help Entry CCGE525_37010     CDS       T05891                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rjg  Rhizobium jaguaris Pathway rjg00261   Monobactam biosynthesis rjg01100   Metabolic pathways rjg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rjg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CCGE525_37010  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rjg01008]     CCGE525_37010 Polyketide biosynthesis proteins [BR:rjg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CCGE525_37010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYG64355 UniProt:  A0A387G4T5 LinkDB All DBs Position pRCCGE525a:complement(38737..38955) Genome browser AA seq 72 aa AA seqDB search MTNPFDDPHATFLVLVNDEGQHSLWPEFVDVPAGWHTGFGPATRHACLDQIETRWTDMRP NSLKAAIEAEAP NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgactaaccccttcgacgatccccatgctaccttcctggtgctggtcaatgacgagggt cagcactctctgtggcccgaatttgtagacgtccctgctggctggcacaccggcttcgga cccgccacccgccacgcgtgcctcgatcaaatcgagacgcgctggaccgacatgcggccc aacagccttaaggctgccatcgaagcagaggctccgtaa

DBGET integrated database retrieval system