Rhizobium laguerreae: RlegWSM1455_25325 Help Entry RlegWSM1455_25325 CDS       T08814                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rlw  Rhizobium laguerreae Pathway rlw00261   Monobactam biosynthesis rlw01100   Metabolic pathways rlw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rlw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RlegWSM1455_25325  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rlw01008]     RlegWSM1455_25325 Polyketide biosynthesis proteins [BR:rlw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RlegWSM1455_25325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UFW67649 LinkDB All DBs Position pWSM1455_1:complement(289344..289562) Genome browser AA seq 72 aa AA seqDB search MDNFDPHDDLWIAVIDTELRYSVWPQDKRIPLGWEPAGFAGSRQQCLAHIADVWADPRPL SLRSAIAGDARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggataattttgaccctcacgacgatctctggatcgccgtcatcgacaccgagcttcgc tactcggtctggccgcaggacaagcggattcccctgggctgggagccggcgggctttgcc ggttcgcgccagcaatgcctggcgcatatcgctgacgtctgggcggatccgcgccccctc tccttgcgctcggcaatcgccggcgatgcgcgtctctga

DBGET integrated database retrieval system