Tritonibacter mobilis: K529_016350 Help Entry K529_016350       CDS       T04367                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism rmb  Tritonibacter mobilis Pathway rmb00261   Monobactam biosynthesis rmb01100   Metabolic pathways rmb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rmb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K529_016350  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rmb01008]     K529_016350 Polyketide biosynthesis proteins [BR:rmb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K529_016350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANP42350 UniProt:  A0A1B1A738 LinkDB All DBs Position unnamed1:187551..187748 Genome browser AA seq 65 aa AA seqDB search MTHPDPELWICVKNTEDRWSIWPAALPVPAGWQAQGAPECHADCLARVEQNWQDPRPAAL KEAMA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgacgcaccctgaccccgaactctggatctgcgtgaaaaacaccgaagaccgatggtcg atctggcccgccgcgctaccggtgcctgcaggttggcaggcacaaggcgcacccgaatgt cacgccgattgccttgcgagggtggagcagaactggcaggatccccgccctgctgcgctg aaggaggctatggcatga

DBGET integrated database retrieval system