Rhodococcus opacus PD630: Pd630_LPD01223 Help Entry Pd630_LPD01223    CDS       T03071                                  Name (GenBank) Protein mbtH   KO K05375   MbtH protein Organism roa  Rhodococcus opacus PD630 Pathway roa00261   Monobactam biosynthesis roa01100   Metabolic pathways roa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:roa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pd630_LPD01223  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:roa01008]     Pd630_LPD01223 Polyketide biosynthesis proteins [BR:roa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pd630_LPD01223 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHK28457 LinkDB All DBs Position 1255144..1255395 Genome browser AA seq 83 aa AA seqDB search MSTNPFDDEEGRFYVLVNDEDQHSLWPTFSEVPAGWRVVFGEESRAACLEYVEKNWTDMR PKSLREAMEADEKSGGRHSVDKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccattcgatgacgaagaaggccgcttctacgtgctggtgaacgatgag gaccagcactcactgtggcccacgttctctgaggtgccggcaggctggcgcgtagttttc ggcgaggaaagccgggccgcgtgcctcgagtacgtggagaagaactggaccgacatgcgg ccgaagagcctgcgtgaggccatggaggccgacgagaagtcgggcggacggcacagcgtc gacaagagctga

DBGET integrated database retrieval system