Romboutsia sp. CE17: HF520_07890 Help Entry HF520_07890       CDS       T06535                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism roc  Romboutsia sp. CE17 Pathway roc00790   Folate biosynthesis roc01100   Metabolic pathways roc01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:roc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HF520_07890 (folB) Enzymes [BR:roc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HF520_07890 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HF520_07890 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HF520_07890 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Cnd1 DALR_2 Motif Other DBs NCBI-ProteinID:  QJA08872 UniProt:  A0A6H1X097 LinkDB All DBs Position complement(1640443..1640808) Genome browser AA seq 121 aa AA seqDB search MDKILLSNLGFYGYHGVLKEESVLGQKFFIDMELLLDTKEAGINDDMNKSVSYAEVYDIV KEIAEKRRFNLIEALAETIAKETLEKFKLINEVMVRVKKPEAPVNGIYDYFGVEIRRSRN E NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggataagatactattaagtaatttaggattttatggatatcatggagtcctaaaagaa gaaagtgtattaggacaaaagttttttatagatatggaacttttacttgatactaaagaa gcaggtattaatgatgatatgaataagtctgttagttatgcagaggtttatgatatagta aaggaaattgcagaaaaaagaaggtttaatcttatagaagctttggcagaaacaatagcc aaagaaacgttagagaaatttaaacttataaatgaagtaatggttagagttaaaaaacct gaggctcctgtaaatggaatttatgactactttggagttgaaataaggagaagtagaaat gaataa

DBGET integrated database retrieval system