Roseovarius sp. THAF27: FIU89_01245 Help Entry FIU89_01245       CDS       T06352                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism roh  Roseovarius sp. THAF27 Pathway roh00400   Phenylalanine, tyrosine and tryptophan biosynthesis roh01100   Metabolic pathways roh01110   Biosynthesis of secondary metabolites roh01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:roh00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     FIU89_01245 Enzymes [BR:roh01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      FIU89_01245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  QFT79218 UniProt:  A0A5P9GVS2 LinkDB All DBs Position complement(245121..245420) Genome browser AA seq 99 aa AA seqDB search MTDADTSRAAALLKGHRESIDRLDAILVYTLGERFKHTQAVGALKAEHDLPPSDPAREAQ QIARLEDLAHRADLDPEFAKKFLNFIIAEVIQHHKQHQT NT seq 300 nt NT seq  +upstreamnt  +downstreamnt ttgactgacgccgacacctcccgcgccgcggcccttctgaaggggcaccgcgaaagcatc gaccggctcgatgccatcctcgtctataccctgggtgaacgcttcaagcacacccaggcc gtgggtgcgctcaaggccgaacacgaccttcccccgtccgatcccgcccgcgaggcgcaa cagatcgcacggctcgaagacctggcgcaccgcgccgacctcgacccggaattcgccaag aaattcctcaacttcatcatcgctgaagtgattcagcaccataagcaacaccagacctga

DBGET integrated database retrieval system