Roseimicrobium sp. ORNL1: G5S37_20095 Help Entry G5S37_20095       CDS       T06460                                  Name (GenBank) FolB domain-containing protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism roo  Roseimicrobium sp. ORNL1 Pathway roo00790   Folate biosynthesis roo01100   Metabolic pathways roo01240   Biosynthesis of cofactors Module roo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:roo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     G5S37_20095 Enzymes [BR:roo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      G5S37_20095  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      G5S37_20095  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      G5S37_20095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QIF03724 UniProt:  A0A6G6K8F0 LinkDB All DBs Position complement(4947481..4947846) Genome browser AA seq 121 aa AA seqDB search MSGDEIHILGLEMPVRIGVPEAERAAWQTVSADITVTLACAFDKMHDELSDTLDYERAAN EATALAASRPRQLLETLAADLVGHFLQDERVRAVEVLLRKRILPHTDAVAVRMRRERPGT R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgtctggcgacgaaattcacatccttggcctggaaatgccggttcgcatcggtgtgccg gaggccgagcgcgcggcctggcagaccgtcagtgcggacatcactgtcactttagcctgt gcatttgacaaaatgcatgatgaactcagtgataccctcgactatgaacgcgccgccaat gaagccaccgccctggcggcttcgcgtccccgtcagctccttgaaacgctggcagcggac ctcgtgggccactttttgcaagatgagcgcgttcgtgcggtggaagtccttctccgcaaa cgtatcctaccccatactgatgccgtggctgtccgcatgcgccgggaacgtcccgggacg cgctaa

DBGET integrated database retrieval system