Rhodococcus opacus B4: ROP_48150 Help Entry ROP_48150         CDS       T00882                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism rop  Rhodococcus opacus B4 Pathway rop00261   Monobactam biosynthesis rop01100   Metabolic pathways rop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rop00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ROP_48150  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rop01008]     ROP_48150 Polyketide biosynthesis proteins [BR:rop01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ROP_48150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAH53062 NITE:  ROP_48150 UniProt:  C1BBK9 LinkDB All DBs Position 5194917..5195168 Genome browser AA seq 83 aa AA seqDB search MSTNPFDDEEGRFYVLVNDEDQHSLWPTFSEVPAGWRVVFGEESRAACLEYVEKNWTDMR PKSLREAMEADEKSGGRHSVDKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccattcgatgacgaagaaggccgcttctacgtgctggtgaacgacgag gaccagcactcactgtggcccacgttctctgaggtgccggcaggctggcgcgtggttttc ggcgaggaaagccgggcagcctgcctcgagtacgtggagaagaactggaccgacatgcgg ccgaagagcctgcgtgaggccatggaggccgacgagaagtcgggcggacggcacagcgtc gacaagagctga

DBGET integrated database retrieval system