Rhizobium phaseoli: AMC79_PD00674 Help Entry AMC79_PD00674     CDS       T04590                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rpha  Rhizobium phaseoli Pathway rpha00261   Monobactam biosynthesis rpha01100   Metabolic pathways rpha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpha00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AMC79_PD00674  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rpha01008]     AMC79_PD00674 Polyketide biosynthesis proteins [BR:rpha01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AMC79_PD00674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANM01842 UniProt:  A0A2U3CR61 LinkDB All DBs Position pRphaN261d:complement(729144..729362) Genome browser AA seq 72 aa AA seqDB search MDNLEPRDDLWIVVIDTERHYSVWPQDKRIPVSWEAAGFAGSRQECLAHIREIWTDPRPL SLRSAMAGDARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacaatcttgagccccgcgacgatctctggatcgtcgtcatcgacaccgagcgccac tactcggtctggccgcaggacaagcggattccggtgagctgggaggccgcgggctttgcc ggttcgcgccaggaatgcctcgcccatatccgcgagatctggaccgatccccgcccgctc tccctgcgctcggccatggccggcgatgcgcgtctctga

DBGET integrated database retrieval system