Rhodococcus pseudokoreensis: JWS13_18395 Help Entry JWS13_18395       CDS       T08508                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rpsk  Rhodococcus pseudokoreensis Pathway rpsk00261   Monobactam biosynthesis rpsk01100   Metabolic pathways rpsk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpsk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JWS13_18395  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rpsk01008]     JWS13_18395 Polyketide biosynthesis proteins [BR:rpsk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JWS13_18395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QSE90452 LinkDB All DBs Position complement(2895409..2895660) Genome browser AA seq 83 aa AA seqDB search MSTNPFDDEEGRFYVLVNDEDQHSLWPTFSEVPAGWRVVFGEESRAACLEYVEKNWTDMR PKSLREAMEADEKSGGRHSVDKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccattcgatgacgaagaaggccgcttctacgtgctggtgaacgatgag gaccagcactcactgtggcccacgttctctgaggtgccggcaggctggcgcgtggttttc ggcgaggaaagccgggcagcctgcctcgagtacgtggagaagaactggaccgacatgcgg ccgaagagcctgcgtgaggccatggaggccgacgagaagtcgggcggacggcacagcgtc gacaagagctga

DBGET integrated database retrieval system