Ralstonia pseudosolanacearum RS 476: CDC45_20820 Help Entry CDC45_20820       CDS       T05645                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rpu  Ralstonia pseudosolanacearum RS 476 Pathway rpu00261   Monobactam biosynthesis rpu01100   Metabolic pathways rpu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CDC45_20820  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rpu01008]     CDC45_20820 Polyketide biosynthesis proteins [BR:rpu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CDC45_20820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AST29651 LinkDB All DBs Position unnamed:complement(781210..781416) Genome browser AA seq 68 aa AA seqDB search MNRTSTGEAPSDFCVVVNDEGQYSLWRSDLPIPGGWRETGMAGNRQACIDYVDQVWTDMR PASLRQRQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcaccagcacaggcgaagcgccatcggatttttgcgttgttgttaacgacgag ggccagtattcgttatggcgttcggatctgccgatccccggcgggtggcgtgaaacaggc atggccggaaaccggcaggcgtgcatcgactatgtcgaccaggtctggaccgacatgcgc ccggccagtctccgtcagcgccagtga

DBGET integrated database retrieval system