Rhodococcus qingshengii: C1M55_03520 Help Entry C1M55_03520       CDS       T05315                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rqi  Rhodococcus qingshengii Pathway rqi00790   Folate biosynthesis rqi01100   Metabolic pathways rqi01240   Biosynthesis of cofactors Module rqi_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rqi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     C1M55_03520 (folB) Enzymes [BR:rqi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      C1M55_03520 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      C1M55_03520 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      C1M55_03520 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AUS30260 UniProt:  A0A1C4EYF9 LinkDB All DBs Position 1:762238..762603 Genome browser AA seq 121 aa AA seqDB search MGDRIELRGLKVRGNHGVFDHEKRDGQDFFIDITVWMDLAPAAASDDLTQTLHYGELAEA AAAIVAGPSRDLIETVAAEIADDVMKDSRVESVEVVVHKPSAPIPLVFADVAVVAHRTRS A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgggggaccgaatcgaattgcgcggactgaaggttcgcggcaatcacggagtgttcgac cacgagaagcgtgacggtcaggacttcttcatcgacatcaccgtatggatggacttggct cccgccgcggcgtcggacgacctgacgcagaccctgcactacggcgagttggcggaagcc gccgcagcgatagtcgccggcccgtcgcgcgatctcatcgagaccgtcgccgctgagatc gccgacgacgtcatgaaagattcgcgagtcgagagcgtcgaggttgttgtccacaaaccg tcggcaccgattccgctggtttttgcggacgtcgccgtcgtcgcacatcggaccagatcg gcatga

DBGET integrated database retrieval system