Rathayibacter rathayi: C1O28_04530 Help Entry C1O28_04530       CDS       T05845                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rry  Rathayibacter rathayi Pathway rry00261   Monobactam biosynthesis rry01100   Metabolic pathways rry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rry00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C1O28_04530  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rry01008]     C1O28_04530 Polyketide biosynthesis proteins [BR:rry01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C1O28_04530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZZ48548 UniProt:  A0A2S5Y1W8 LinkDB All DBs Position 921931..922158 Genome browser AA seq 75 aa AA seqDB search MSDNPFDDESGRFLVLINAEDQHSLWPIFAPVPGGWSIAYGGQHGADRAECLAFVEANWT DLRPRSLRAAQDATP NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacccgttcgatgacgagagcggccgcttcctcgtgctgatcaacgccgag gaccagcattcgctctggccgatcttcgcccccgtccctggcggctggagcatcgcctac ggcgggcagcacggcgcggatcgcgcagagtgcctggcgttcgtcgaggcgaactggacc gacctgcggccccgcagcctgcgggcggcgcaggacgcgacgccgtga

DBGET integrated database retrieval system