Rhodococcus ruber: CS378_19050 Help Entry CS378_19050       CDS       T05142                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rrz  Rhodococcus ruber Pathway rrz00790   Folate biosynthesis rrz01100   Metabolic pathways rrz01240   Biosynthesis of cofactors Module rrz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rrz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CS378_19050 (folB) Enzymes [BR:rrz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CS378_19050 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CS378_19050 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CS378_19050 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF6665 Motif Other DBs NCBI-ProteinID:  ATQ30617 UniProt:  A0A098BQQ0 LinkDB All DBs Position 4192575..4192943 Genome browser AA seq 122 aa AA seqDB search MSDRIELRGLRVRGHHGVFDHEKRDGQDFLVDIVAWLDLAPAAASDALDDTLHYGILAER AAAIVAGPSRDLIETVAGEIAADVLTDPRVTRVEVTLHKPSAPIPLTFADVAVVVERTRS GS NT seq 369 nt NT seq  +upstreamnt  +downstreamnt gtgagcgaccggatcgaactgcgcggactgcgggtccgcggccaccacggggtgttcgac cacgagaagcgcgacggccaggacttcctggtggacatcgtcgcgtggctcgatctcgca ccggctgcggcgagcgacgccctcgacgacaccctgcactacggcatcctcgccgagcgg gccgccgcgatcgtcgcgggcccgtcacgcgacctcatcgagaccgttgccggtgagatc gccgccgacgtcctcaccgacccgcgggtcacccgggtcgaggtcaccctgcacaagccg tcggcgccgatcccgctgaccttcgcggacgtggcggtggtggtcgagcgcacccggagc ggctcgtga

DBGET integrated database retrieval system