Ralstonia pseudosolanacearum FQY_4: F504_4584 Help Entry F504_4584         CDS       T02751                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rse  Ralstonia pseudosolanacearum FQY_4 Pathway rse00261   Monobactam biosynthesis rse01100   Metabolic pathways rse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rse00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F504_4584  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rse01008]     F504_4584 Polyketide biosynthesis proteins [BR:rse01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F504_4584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGH87092 LinkDB All DBs Position megaplasmid:1408194..1408400 Genome browser AA seq 68 aa AA seqDB search MNRTSTGEAPSDFCVVVNDEGQYSLWRSDLPIPGGWRETGMAGNRQACIDYVDQVWTDMR PASLRQRQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcaccagcacaggcgaagcgccatcggatttttgcgttgttgttaacgacgag ggccagtattcgttatggcgttcggatctgccgatccccggcgggtggcgtgaaacaggc atggccggaaaccggcaggcgtgcatcgactatgtcgaccaggtctggaccgacatgcgc ccggccagtctccgtcagcgccagtga

DBGET integrated database retrieval system