Ralstonia solanacearum CMR15: CMR15_mp10592 Help Entry CMR15_mp10592     CDS       T02725                                  Name (GenBank) conserved hypothethical protein   KO K05375   MbtH protein Organism rsm  Ralstonia solanacearum CMR15 Pathway rsm00261   Monobactam biosynthesis rsm01100   Metabolic pathways rsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CMR15_mp10592  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rsm01008]     CMR15_mp10592 Polyketide biosynthesis proteins [BR:rsm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CMR15_mp10592 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CBJ40242 LinkDB All DBs Position CMR15_mp:complement(660466..660672) Genome browser AA seq 68 aa AA seqDB search MNRTSTGEVPSDFFVVINDEGQYSLWRSDLPIPGGWRETGMAGSRQACIDYVDQVWTDMR PASLRQRQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcaccagcacaggcgaagtgccatcggattttttcgttgtcataaacgacgaa ggccaatattcgttatggcgctcggatctgccgatccccggcgggtggcgtgaaaccggc atggccggaagccggcaggcgtgcatcgactatgtcgaccaggtctggaccgacatgcgc ccggccagtctccgtcagcgccagtga

DBGET integrated database retrieval system