Roseivirga spongicola: T7867_10470 Help Entry T7867_10470       CDS       T09626                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rsr  Roseivirga spongicola Pathway rsr00790   Folate biosynthesis rsr01100   Metabolic pathways rsr01240   Biosynthesis of cofactors Module rsr_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rsr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     T7867_10470 (folB) Enzymes [BR:rsr01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      T7867_10470 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      T7867_10470 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      T7867_10470 (folB) BRITE hierarchy Motif Pfam:  FolB DUF1081 Motif Other DBs NCBI-ProteinID:  WPZ08683 LinkDB All DBs Position 2365163..2365528 Genome browser AA seq 121 aa AA seqDB search MNKDIVALEGMEFYAFHGFYEEEREKGNHFVVDVALTTSFEKAAETDELSGTVNYEELHA LVKAEMEISTKLLERVAGRIIEKCFEQFPTVTEVKVAVAKKNPPIDAPIAQSKITMIRVR K NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaataaagatatcgttgcactggaaggcatggagttctatgcctttcatggtttttat gaagaggagagagaaaagggtaatcattttgtggtggatgttgccctgactacctcattc gaaaaggccgctgaaacagacgagctttccggaaccgtcaactacgaagagcttcatgcc ttggtgaaggctgaaatggaaatatcgaccaaacttttagagcgagttgccggcagaatc attgaaaagtgcttcgagcagtttccaacagttacagaagtaaaagtagctgtggctaag aagaacccacctattgatgctcctattgctcaatctaagattacaatgatcagggtgcgt aagtag

DBGET integrated database retrieval system