Ralstonia solanacearum UY031: RSUY_38510 Help Entry RSUY_38510        CDS       T06155                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism rsy  Ralstonia solanacearum UY031 Pathway rsy00261   Monobactam biosynthesis rsy01100   Metabolic pathways rsy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RSUY_38510  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rsy01008]     RSUY_38510 Polyketide biosynthesis proteins [BR:rsy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RSUY_38510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALF90159 UniProt:  A0A072ZUX4 LinkDB All DBs Position unnamed:complement(799104..799310) Genome browser AA seq 68 aa AA seqDB search MNLTRTTEEQSSFCVVVNAEGQYSLWNSDLPIPSGWRETGMTGNKRACIDYVDQVWTDMR PASLRQRQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaacctcacccgtacgaccgaagagcaatccagtttctgcgttgtcgtcaacgccgag ggccagtattcgttatggaattcggatctgccgattcccagcggatggcgtgaaacgggc atgaccggaaacaagcgggcgtgtatcgattacgtcgaccaggtctggaccgacatgcgc ccggccagtctccgccagcgtcaataa

DBGET integrated database retrieval system