Rhincodon typus (whale shark): 109917684 Help Entry 109917684         CDS       T06055                                  Name (RefSeq) ferritin heavy chain B-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109917684  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109917684    04217 Necroptosis     109917684  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109917684 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109917684 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109917684   Exosomal proteins of bladder cancer cells    109917684 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin ANAPC4 HEPN_RES_NTD1 Motif Other DBs NCBI-GeneID:  109917684 NCBI-ProteinID:  XP_048450038 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search SFYFDRDDVALRHFAEFFKEQSHEEWKHAEKLMAFQNKRGGRVLLQDIKKPEQDEWGSGL EAMQRALQMEKDVNQSLLDLHKLASGNTDPHLSDFLERHYLDEQLKMIKKLGDHITSLKR LGAPENGMGEYLFDRLTLGEE NT seq 426 nt NT seq  +upstreamnt  +downstreamnt tccttttactttgaccgggatgatgttgccctgcgtcactttgctgagttcttcaaggag cagtcccatgaggaatggaaacacgctgagaaactgatggcattccagaataaacgtgga ggccgggtcctcctgcaggacatcaagaagccagagcaggatgagtggggcagtggtctg gaggcaatgcagagagctctgcagatggagaaggatgtgaaccagagtctgctggatctg cacaaacttgcctctggcaacacggaccctcacctgagtgacttcctggagaggcactac ttggatgagcaattgaagatgatcaagaagctgggagatcacatcaccagcctgaagaga ctgggagcccctgagaatggcatgggagagtacctgtttgacaggctcaccctgggggaa gagtga

DBGET integrated database retrieval system