Rhincodon typus (whale shark): 109930384 Help Entry 109930384         CDS       T06055                                  Name (RefSeq) ferritin heavy chain B-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109930384  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109930384    04217 Necroptosis     109930384  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109930384 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109930384 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109930384   Exosomal proteins of bladder cancer cells    109930384 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin ANAPC4 Motif Other DBs NCBI-GeneID:  109930384 NCBI-ProteinID:  XP_048450646 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search SFYFDRDDVALRHFAEFFKEESHEEREHTEKLIAFQNKRGGRVLLQDVKKPEQDEWGSGL EAMQRALQMEKDVNQSLLDLHKLASGNTDPHLCDFLERNYLDEQVKMIKKLGDHITNLKR LGAPENGMGEYLFDRLTLGESD NT seq 429 nt NT seq  +upstreamnt  +downstreamnt tccttttactttgaccgggatgatgttgccctgcgtcacttcgctgagttcttcaaggag gagtcccacgaggaacgggaacacactgagaaactgatagcattccagaataaacgtgga ggccgagtcctcctgcaggacgtcaagaagccagagcaggatgagtggggcagtggtctg gaggcaatgcagagagctctgcagatggagaaggatgtgaaccagagtctgctggatctg cacaaactcgcctctggcaacacagaccctcatctgtgtgacttcctggagaggaactac ttggatgagcaagtgaagatgatcaagaagctgggagatcacatcaccaacctgaagaga ctgggagcccctgagaatggcatgggagagtacctgtttgacaggctcaccctgggggag agtgactga

DBGET integrated database retrieval system