Rhincodon typus (whale shark): 109931175 Help Entry 109931175         CDS       T06055                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109931175  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109931175    04217 Necroptosis     109931175  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109931175 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109931175 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109931175   Exosomal proteins of bladder cancer cells    109931175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin FCH PAD_porph Rubrerythrin Uteroglobin Motif Other DBs NCBI-GeneID:  109931175 NCBI-ProteinID:  XP_048449485 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MASQVCQNYHKDCEDAVNKQINLELYSSYVYVSMFSHFDRDDVALRHFAEFFKEQSHEER EHAEKLMAFQNKRGGRVLLQDIKKPEQDEWGNPLEAMQRALQMEKDVNQSLLDLHKLSSG NTDSLVSS NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggcttcccaagtgtgtcagaactaccacaaggactgtgaggatgctgttaacaagcag atcaacttggagctctattcctcctatgtttacgtctccatgttctctcactttgaccgg gatgatgttgccctgcgtcactttgctgagttcttcaaggagcagtctcacgaggaacgg gaacacgctgagaaactgatggcattccagaataaacgtggaggccgggtcctcctgcag gacatcaagaagccagagcaagatgagtggggcaatcctctggaggcaatgcagagagct ctgcagatggagaaggatgtgaaccagagtctgctggatctgcacaaactctcctctggc aacacggactctctcgtgagttcctga

DBGET integrated database retrieval system