Rhincodon typus (whale shark): 109931440 Help Entry 109931440         CDS       T06055                                  Name (RefSeq) ferritin, heavy subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109931440  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109931440    04217 Necroptosis     109931440  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109931440 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109931440 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109931440   Exosomal proteins of bladder cancer cells    109931440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Coat_F Motif Other DBs NCBI-GeneID:  109931440 NCBI-ProteinID:  XP_048450767 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MASQICQNYHQDCEAAVNKQINVELTASYLYQSLISYFDRDDVALPHFSRFFKDQSQEKQ EHAEKLLKFQNQRGGRVLLQDVKKPERDEWGNSLQAMQVAL NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcctcccagatttgtcaaaactatcaccaggattgtgaagctgctgtcaacaaacag attaatgtggagctcactgcttcctatctctatcagtctttgatctcctactttgaccgg gatgatgttgccctcccccatttctcccggttcttcaaagatcagtcccaggagaagcag gaacatgcagagaagctgctgaaattccagaatcagcgtggaggcagagtcctcctccag gatgtgaagaagccagagagggatgagtggggtaacagtctgcaggcaatgcaggttgcc ctg

DBGET integrated database retrieval system