Rhincodon typus (whale shark): 109932353 Help Entry 109932353         CDS       T06055                                  Name (RefSeq) ferritin, heavy subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109932353  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109932353    04217 Necroptosis     109932353  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109932353 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109932353 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109932353   Exosomal proteins of bladder cancer cells    109932353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Coat_F Motif Other DBs NCBI-GeneID:  109932353 NCBI-ProteinID:  XP_048450734 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MASQISQNYHQDCEAAVNRQINVELTASYLHQSLMSYFDRDDVALPHFSRFFKDQSQEKQ EHAEKLLKFQNQRGGRVLLQDVKKPERDEWGNSLQAMQVALDLEKNVNQSLLDLHQLATA QTDPHLCDFLETHYL NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggcctcccagattagtcaaaactatcaccaggattgtgaagctgctgttaacaggcag attaatgtggagctcactgcctcctatctccatcagtctttgatgtcgtactttgaccgg gacgatgttgccctcccccatttctcccggttcttcaaagatcagtcccaggagaagcag gaacatgcagagaagctgttgaaattccagaatcagcgtggaggcagagtcctcctccag gatgtgaagaagccagagagggatgagtggggtaacagtctgcaggcaatgcaggttgcc ctggatctggagaagaatgtgaaccagagtttgctggatctacaccaactcgccactgcc cagactgacccccatctgtgtgacttcctggagactcactatttg

DBGET integrated database retrieval system