Rhincodon typus (whale shark): 109938388 Help Entry 109938388         CDS       T06055                                  Name (RefSeq) ferritin, heavy subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109938388  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109938388    04217 Necroptosis     109938388  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109938388 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109938388 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109938388   Exosomal proteins of bladder cancer cells    109938388 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin FCH Rubrerythrin Motif Other DBs NCBI-GeneID:  109938388 NCBI-ProteinID:  XP_048449561 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MASQVCQNYHKDCEDAVNKQINLELYSSYVYLSMSSFFDRDDVALHHFAEFFKEQSHEER EHAEKLMAFQNKRGGRVLLQDIKKPEQDEWGSGLEAMQRALQMEKDVNQSLLDLHKLASG HMDPH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcctcccaagtgtgtcagaactaccacaaagactgtgaggatgctgttaacaagcag atcaacctggagctctattcctcctatgtttacctgtccatgtcctctttctttgaccgg gatgatgttgccctgcatcactttgctgagttcttcaaggagcagtcccacgaggaacgg gaacacgctgagaagctgatggcattccagaataaacgtggaggccgagtcctcctgcag gacatcaagaagccagagcaggatgagtggggcagtggtctggaggcaatgcagagagct ctgcagatggagaaggatgtgaaccagagtctgctggatctgcacaaactcgcctctggc cacatggaccctcat

DBGET integrated database retrieval system