Rhincodon typus (whale shark): 109938393 Help Entry 109938393         CDS       T06055                                  Name (RefSeq) ferritin heavy chain B-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism rtp  Rhincodon typus (whale shark) Pathway rtp00860   Porphyrin metabolism rtp04216   Ferroptosis rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109938393  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109938393    04217 Necroptosis     109938393  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109938393 Enzymes [BR:rtp01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109938393 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109938393   Exosomal proteins of bladder cancer cells    109938393 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin FCH Motif Other DBs NCBI-GeneID:  109938393 NCBI-ProteinID:  XP_048450616 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MASQVRQNYREDCEAAVNKQINLELYSSYVYLSMSFYFDRDDVALRHFAEFFKEESHEER EHAKKLMAFQNKRGGRVLLQDVKKAEQDEWDSGLGAMQRALQMEKDVNQSLLDLHKLASG NMDPH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcctcccaagtgcgtcagaactaccgtgaggactgtgaagctgctgttaacaagcag atcaacctggagctctattcctcttatgtttacctctccatgtccttttactttgaccgg gatgatgttgctctgcgtcactttgctgagttcttcaaggaggagtcccacgaggaacgg gaacatgctaagaaactgatggcattccagaataaacgtggtggccgagtcctcctgcag gatgtcaagaaggcagagcaggatgagtgggacagtggtctgggggcaatgcagagagct ctgcagatggagaaggatgtgaaccagagtctgctggatctgcacaaactcgcctctggc aacatggaccctcat

DBGET integrated database retrieval system