Saccharopolyspora sp. ASAGF58: FDZ84_18115 Help Entry FDZ84_18115       CDS       T06538                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sacg  Saccharopolyspora sp. ASAGF58 Pathway sacg00261   Monobactam biosynthesis sacg01100   Metabolic pathways sacg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sacg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FDZ84_18115  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sacg01008]     FDZ84_18115 Polyketide biosynthesis proteins [BR:sacg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FDZ84_18115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIZ36243 UniProt:  A0A6H1R9H4 LinkDB All DBs Position 3789150..3789338 Genome browser AA seq 62 aa AA seqDB search MTNPFEDPAAEYYALINEQDQYSLWPAAIAVPAGWTIAHGPADRESCVDHIEVNWTDMRP AC NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgaagatccggccgcggagtactacgcgctgatcaacgagcaggac cagtactcgctgtggcccgccgcgatcgccgtgcccgccgggtggaccatcgcgcacggc ccggccgaccgggagtcctgcgtggaccacatcgaggtgaactggaccgacatgcggccc gcgtgctga

DBGET integrated database retrieval system