Saccharopolyspora sp. ASAGF58: FDZ84_24940 Help Entry FDZ84_24940       CDS       T06538                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sacg  Saccharopolyspora sp. ASAGF58 Pathway sacg00261   Monobactam biosynthesis sacg01100   Metabolic pathways sacg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sacg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FDZ84_24940  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sacg01008]     FDZ84_24940 Polyketide biosynthesis proteins [BR:sacg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FDZ84_24940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIZ37270 UniProt:  A0A6H1RAX4 LinkDB All DBs Position 5265419..5265622 Genome browser AA seq 67 aa AA seqDB search MTNPFDDEDGTFLVLRNEQAQHSLWPAFAAVPAGWEVVCAETSRAEALSYVELNWTDLRP ASLRETP NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgacgacgaggacggcacgttcctggtgctgcgcaacgagcaggcg cagcactccctgtggccggcgttcgccgcggtgcccgcgggctgggaggtggtgtgtgcg gagaccagccgggcggaggcgctcagctacgtcgagctcaactggaccgacctgcgcccg gcgagcctgcgcgagacgccctga

DBGET integrated database retrieval system