Streptococcus acidominimus: SAME_01386 Help Entry SAME_01386        CDS       T08039                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism saco  Streptococcus acidominimus Pathway saco00790   Folate biosynthesis saco01100   Metabolic pathways saco01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:saco00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SAME_01386 (folB) Enzymes [BR:saco01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SAME_01386 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SAME_01386 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SAME_01386 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  SNV41695 UniProt:  A0A239X4R9 LinkDB All DBs Position 1:complement(1335112..1335390) Genome browser AA seq 92 aa AA seqDB search MDQITLTNCRFYGYHGALAEENRLGQIFVISAKLTVDLSAASLSDRLEDTVHYGMVFDCI KNQAENHRYQLIERLAGAICQDIFDQFPQSLP NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggatcagattaccttaacaaattgccgcttctacggttaccatggcgctttagcagaa gagaatcgtctaggacaaatctttgtgatttcagctaagttgactgttgatctctcagcg gcttctttatcagatcgcctggaggacacggtgcattatgggatggtttttgactgtatc aaaaatcaagcggaaaatcatcgctatcaactgattgaacgcttagcaggagctatttgt caggatatttttgaccaatttccccagtcactgccatag

DBGET integrated database retrieval system