Streptomyces actuosus: DMT42_25260 Help Entry DMT42_25260       CDS       T08084                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sact  Streptomyces actuosus Pathway sact00261   Monobactam biosynthesis sact01100   Metabolic pathways sact01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sact00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DMT42_25260  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sact01008]     DMT42_25260 Polyketide biosynthesis proteins [BR:sact01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DMT42_25260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWT45267 UniProt:  A0A2U9P6U8 LinkDB All DBs Position complement(5396444..5396662) Genome browser AA seq 72 aa AA seqDB search MANPFENDEASYYVLVNDEGQHSLWPAFAEIPAGWKAVHGEDTRAACLEYVERNWTDMRP LSLVHAMAGTGA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtggcgaatccgttcgagaacgacgaggcgtcctactacgtgctcgtcaacgacgagggg cagcactccctgtggccggcgttcgcggagatcccggccggctggaaggccgtgcacggc gaggacacccgcgccgcctgcctggagtacgtggagcggaactggaccgacatgcgcccg ctcagcctggtgcacgccatggccggcaccggcgcctga

DBGET integrated database retrieval system