Saccharothrix sp. 6-C: IOD16_10980 Help Entry IOD16_10980       CDS       T09941                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sacx  Saccharothrix sp. 6-C Pathway sacx00261   Monobactam biosynthesis sacx01100   Metabolic pathways sacx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sacx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IOD16_10980  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sacx01008]     IOD16_10980 Polyketide biosynthesis proteins [BR:sacx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IOD16_10980 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QQQ78898 LinkDB All DBs Position 2425697..2425891 Genome browser AA seq 64 aa AA seqDB search MTNPFEDPEGRFHVLVNHEGQHSLWPSFADIPAGWTSRFGPDTRDACVAYVEEHWTDLRP LSLR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgaccaacccgttcgaagaccccgaaggccgcttccacgtcctggtcaaccacgagggc cagcactccctgtggccgtcgttcgccgacatccccgccggctggaccagccgcttcggc cccgacacccgtgacgcctgcgtcgcctacgtggaggagcactggaccgacctgcgcccc ctgtcgctgcgttga

DBGET integrated database retrieval system