Saccharothrix sp. 6-C: IOD16_12925 Help Entry IOD16_12925       CDS       T09941                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sacx  Saccharothrix sp. 6-C Pathway sacx00261   Monobactam biosynthesis sacx01100   Metabolic pathways sacx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sacx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IOD16_12925  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sacx01008]     IOD16_12925 Polyketide biosynthesis proteins [BR:sacx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IOD16_12925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QQQ79242 LinkDB All DBs Position complement(2924440..2924646) Genome browser AA seq 68 aa AA seqDB search MTNPFDRQDGEFLVLVNDEGQHSLWPGDIAVPAGWDVTHGPDTRAACLEHIETTWTDLRP ASLAALRG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccccttcgaccgccaggacggcgagttcctcgtgctggtcaacgacgagggc cagcactcgctgtggcccggcgacatcgcggtcccggccgggtgggacgtcacccacggc ccggacacccgcgccgcctgcctggagcacatcgagaccacctggaccgacctgcgcccg gcgagcctcgccgccctgcgcggctga

DBGET integrated database retrieval system