Saccharothrix sp. 6-C: IOD16_38380 Help Entry IOD16_38380       CDS       T09941                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sacx  Saccharothrix sp. 6-C Pathway sacx00790   Folate biosynthesis sacx01100   Metabolic pathways sacx01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:sacx00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IOD16_38380 (folB) Enzymes [BR:sacx01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      IOD16_38380 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      IOD16_38380 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      IOD16_38380 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QQQ81037 LinkDB All DBs Position 8782547..8782909 Genome browser AA seq 120 aa AA seqDB search MSDRISLRGLRVRGFHGVFEHEKRDGQDFLVDVTAWLDLSRAAATDDLRETLHYGELAER TAAIVAGGPYDLIETVAGKVADEVMTDLRVRAVEVTVHKPSAPIPLAFADVSVTIRRTRD NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atctcggatcggatctcgctgcgcggcctgcgggtgcgcgggttccacggcgtgttcgag cacgagaagcgcgacggccaggacttcctggtcgacgtcaccgcgtggctggacctgtcg cgcgcggcggccaccgacgacctgcgggagacgctgcactacggcgagctggccgagcgg accgcggcgatcgtggccggcgggccgtacgacctgatcgagacggtggcgggcaaggtc gccgacgaggtgatgaccgacctgcgggtgcgggcggtcgaggtgaccgtgcacaagccg tcggccccgatcccgctggcgttcgcggacgtctcggtgaccatccggcgcacgcgtgac tag

DBGET integrated database retrieval system