Simiduia agarivorans: M5M_09760 Help Entry M5M_09760         CDS       T02281                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism saga  Simiduia agarivorans Pathway saga00790   Folate biosynthesis saga01100   Metabolic pathways saga01240   Biosynthesis of cofactors Module saga_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:saga00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     M5M_09760 Enzymes [BR:saga01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      M5M_09760  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      M5M_09760  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      M5M_09760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFU99135 UniProt:  K4KLN6 LinkDB All DBs Position 2162304..2162657 Genome browser AA seq 117 aa AA seqDB search MTDQIMIEGLWIETVIGVYDWERELRQRLLLDLTLTTDIRPAAASDDLGKTLDYKAITDR IIAFAEGSSHQLVETLAEQIAALVQKEFGVTRLTLKLSKPGALPRAQNVAVFIERGR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgactgaccagatcatgatcgaaggcctgtggatcgagactgtcatcggcgtgtacgac tgggagcgcgaactgcgccaacggctgctgttggacctgacgctgaccaccgatatccgc cccgccgccgccagtgacgacctgggtaaaaccctggattacaaagccattaccgatcgc atcatcgcatttgccgaagggtcatcgcaccagctggtggagaccttagcggagcaaata gccgcactggtacaaaaagaattcggtgtgacccggttgacgttaaagctcagcaagccc ggcgccctgccgcgcgcgcagaatgtggccgtattcatcgagcgtggccgttga

DBGET integrated database retrieval system