Streptomyces akebiae: K1J60_43005 Help Entry K1J60_43005       CDS       T08702                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sakb  Streptomyces akebiae Pathway sakb00261   Monobactam biosynthesis sakb01100   Metabolic pathways sakb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sakb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K1J60_43005  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sakb01008]     K1J60_43005 Polyketide biosynthesis proteins [BR:sakb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K1J60_43005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QYX82421 LinkDB All DBs Position complement(9918383..9918592) Genome browser AA seq 69 aa AA seqDB search MSNPFEDPEGTYLVLVNDENQHSLWPDFVDVPAGWRVVHGPDSRQSCLDHVETHWTDMRP RSLAESMDG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggaccccgagggcacctacctggtgctggtcaacgacgagaac cagcacagcctgtggccggacttcgtggacgtgccggccggctggcgggtggtccacgga cccgactcccggcagtcctgcctggaccacgtcgagacccactggacggacatgcggccg cgcagcctggccgagtcgatggacggctga

DBGET integrated database retrieval system