Streptomyces albidoflavus: XNR_0984 Help Entry XNR_0984          CDS       T02545                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism salb  Streptomyces albidoflavus Pathway salb00261   Monobactam biosynthesis salb01100   Metabolic pathways salb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     XNR_0984  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:salb01008]     XNR_0984 Polyketide biosynthesis proteins [BR:salb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     XNR_0984 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGI87383 UniProt:  D6BB74 LinkDB All DBs Position 1166608..1166814 Genome browser AA seq 68 aa AA seqDB search MSNPFENSDRSYDVLVNDEGQHSLWPTGTTVPAGWRTVLADRSREECLAHVEAHWTDMRP RSLRAATA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgtccaaccccttcgagaactccgaccgttcctacgacgtgctcgtcaacgacgagggc cagcactccctgtggcccaccggcaccaccgtcccggcgggctggcggaccgtgctcgcg gaccgctcccgtgaggagtgcctcgcccacgtcgaggcccactggaccgacatgcgcccg cgcagcctgcgggccgccaccgcctga

DBGET integrated database retrieval system